PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000309356
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 624aa    MW: 70048.3 Da    PI: 7.4086
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000309356genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.65.4e-16741135
           GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                   C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  MDP0000309356  7 CYHCGVTSTPLWRNGPPDKPVLCNACGSRWRTKGT 41
                   ****************55555***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.9E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.14E-11546No hitNo description
CDDcd002027.95E-17654No hitNo description
PROSITE profilePS5011411.345740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-12741IPR013088Zinc finger, NHR/GATA-type
PfamPF003208.3E-14741IPR000679Zinc finger, GATA-type
PfamPF139194.2E-11345455IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPDKPVLCN ACGSRWRTKG TLVNYTPLHA RAEPDDFEDH  60
RVSRVKSISV NKSKEIKLVK RKQNPESMVI GGVNSDYSHG FRKIIEEDKS NRSSSGSAVS  120
NSESCAQFGS GDASDLTGWI LVTVNIQLKM FELSSDFSIY EKLVYFDLNR FKVTITENCD  180
RRMKLMPNVV SFSGPAQSMV WDSMVPSRKR TCIGRLKPSP VERLTKDLYT ILHEQQSSCF  240
SGSSEEDLLF ESETPMVSVE IGHGSVLIRH PNSIAREEES EASSISVDNK QCLANEVYSR  300
SATLFVHNNN KGVNMASTVS GRMNNVVGEG MQHEPLKRDK SQLDNFQILG NHNSPLRHVD  360
LNDILNFEEF TRQLTNEEQQ QLLKHLPAVD VVKFPYRLET LLYDLVAYFV LTTEDRNLRI  420
VYNLKSMFDS PQFRENLTSF QQLLAEGVFD ISFPGVKTED CKTLKRLALS NSPKSKWVER  480
YHLLKKCKTS SGKSVVSGLN MASSNLRHVK RLWDNETHSF PDVKIMKSPK RIIMKGSYEN  540
KDPMDYDGGS CFSPKSLFAL PTDGGSFLMD SMNFVDESSD QDLLLDVPSN GSFAQAELLH  600
PAMSFGAPQA STSSSSIYPH VLHP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.136960.0bud| fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280960.10.0GATA transcription factor 26
SwissprotQ8W4H18e-84GAT26_ARATH; GATA transcription factor 26
TrEMBLD9ZIZ50.0D9ZIZ5_MALDO; GATA domain class transcription factor
STRINGPOPTR_0003s08080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44243155
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-123GATA transcription factor 26